search
Default Language Pack (us-en)FranceDefault Language Pack (us-en)
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Welcome to Parrot Hoodies
£0.00
Parrot/bird Rigid anti-pluck neck wrap collars
Parrot/bird Rigid anti-pluck neck wrap collars Parrot/bird Rigid anti-pluck neck wrap collars Parrot/bird Rigid anti-pluck neck wrap collars

Parrot/bird Rigid anti-pluck neck wrap collars

£11.00 inc. tax
Collar Sizes*:
Description
Take a look at our rigid anti-pluck collars!
Designed to keep those beaks away from feathers and naked chests at bay, these are the perfect deterrent.

The inside is quilted and soft and the outside is rigid to stop them from chewing at their chests!

We have a variety of designs and fabrics will vary, but your purchase will be pot luck!
Details
Product Code: wrapcollars
Units in Stock:
56
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i