search
Default Language Pack (us-en)FranceDefault Language Pack (us-en)
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Welcome to Parrot Hoodies
£0.00
Parrot or Puppy poopy bag/wipe holders
Parrot or Puppy poopy bag/wipe holders Parrot or Puppy poopy bag/wipe holders Parrot or Puppy poopy bag/wipe holders Parrot or Puppy poopy bag/wipe holders Parrot or Puppy poopy bag/wipe holders Parrot or Puppy poopy bag/wipe holders

Parrot or Puppy poopy bag/wipe holders

£3.00 inc. tax
Description
How CUUUUUTE are these little pouches :)
Many designs are available but your purchase will be pot luck!
The size of these bags is approximately 5.5 inch x 4 so they're perfect for storing nuts, treats or poopy wipes and bags!

These are a bargain at £3 and make cute gifts!
Details
Product Code: treatbags
Units in Stock:
98
Brand: Babesinthehood
Product Condition: New
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i