search
Default Language Pack (us-en)FranceDefault Language Pack (us-en)
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Welcome to Parrot Hoodies
£0.00
Greeting Cards HANDMADE 'Plain' - Click for more designs
Greeting Cards HANDMADE 'Plain' - Click for more designs Greeting Cards HANDMADE 'Plain' - Click for more designs Greeting Cards HANDMADE 'Plain' - Click for more designs Greeting Cards HANDMADE 'Plain' - Click for more designs Greeting Cards HANDMADE 'Plain' - Click for more designs Greeting Cards HANDMADE 'Plain' - Click for more designs Greeting Cards HANDMADE 'Plain' - Click for more designs Greeting Cards HANDMADE 'Plain' - Click for more designs Greeting Cards HANDMADE 'Plain' - Click for more designs

Greeting Cards HANDMADE 'Plain' - Click for more designs

£2.85 inc. tax
CARD DESIGNS*:
Description
Check out our beautiful new range of handmade greeting cards!
Be sure to have a browse and choose wisely as we have a wide section available 😊

Our cards include:
Happy Birthday Cards
Happy Christmas 2020 Cards
Happy Holidays Cards
Just to say Cards
Blank Cards (For you to add your own message)

Of course all cards are bird themed (what else huh 😉) and all come complete with envelope which will be shipped to you upon purchase!


 
 


Details
Product Code: xmascards
Units in Stock:
8
Brand: Babesinthehood
Product Condition: New
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i